PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA06G25740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 362aa    MW: 40205.1 Da    PI: 7.923
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA06G25740.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B335.22.2e-11241191395
                      TT-EE--HHH.HTT..............---.....--SEEEEEETTS-EEEEEE..EEETTE...EEE-TTHHHHHHHHT--TT-EEEEEE-S CS
               B3  13 sgrlvlpkkfaeeh..............ggkke...esktltledesgrsWevkliyrkksgr...yvltkGWkeFvkangLkegDfvvFkldg 86 
                      ++rl++p +fa++               +   e   +   + +  + g++W+v+l+  +++ +    +l++GW+e + a+gL eg  vv++l++
  ONIVA06G25740.1  24 LHRLSVPGEFAARLddddaagvgeeeeeE---EsgrRAAAVLVVGPLGKVWRVELR--RSPAGdgeAWLGGGWSELAAAHGLGEGWGVVLRLER 112
                      5899*******999999999987654432...1455677899999**********5..54444447*************************998 PP

                      SSEE..EEE CS
               B3  87 rsefelvvk 95 
                      r  +   ++
  ONIVA06G25740.1 113 RGVA--SLR 119
                      7666..444 PP

2B343.94.4e-14147236397
                      EE-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3   3 kvltpsdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      k l ++d      + +p kf+++h  +  +++++  ++  + g+ W+v+l  ++ +  ++l++GW  F  a++L eg +++F+++g++ f  +v
  ONIVA06G25740.1 147 KLLQQEDL---EKMKIPEKFVQQHltETYTNNHQNAIIVCPLGKFWRVEL--QREQPDVLLRDGWAPFLAAHDLSEGNILLFRYEGNMVF--TV 233
                      55533333...3478**********944445667899999**********..999999****************************9999..66 PP

                      EEE CS
               B3  95 kvf 97 
                       vf
  ONIVA06G25740.1 234 EVF 236
                      665 PP

3B339.11.3e-12270351486
                      E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
               B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                      v ++s  +++ + ++  +f++++g+ +++ +tl++  ++  sW+v ++ + +  +y+ + GW++F+ +n++kegD ++F  ++
  ONIVA06G25740.1 270 VHLSSGKGREELRSVRGTFCSQIGLLEACAITLKISMKKKGSWRVAFK-TANTYGYINGPGWRKFCLENEVKEGDCLTFNAIE 351
                      55666777778889999******************************5.5555579***********************9665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.3E-1310124IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-1112126IPR015300DNA-binding pseudobarrel domain
SMARTSM010197.5E-614124IPR003340B3 DNA binding domain
PfamPF023629.7E-925116IPR003340B3 DNA binding domain
PROSITE profilePS508639.50261124IPR003340B3 DNA binding domain
CDDcd100178.49E-1061114No hitNo description
Gene3DG3DSA:2.40.330.102.2E-20140241IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.24E-20141245IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.407142239IPR003340B3 DNA binding domain
CDDcd100172.36E-15143236No hitNo description
SMARTSM010191.0E-6145239IPR003340B3 DNA binding domain
PfamPF023624.9E-11153236IPR003340B3 DNA binding domain
PROSITE profilePS508639.982267362IPR003340B3 DNA binding domain
SMARTSM010190.31267360IPR003340B3 DNA binding domain
PfamPF023621.2E-9269352IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.7E-12280360IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.0E-10286360IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MPLSAGSLRR RPKFAAPLLS PACLHRLSVP GEFAARLDDD DAAGVGEEEE EEESGRRAAA  60
VLVVGPLGKV WRVELRRSPA GDGEAWLGGG WSELAAAHGL GEGWGVVLRL ERRGVASLRV  120
FDPGFCLARF CTPHAGMRTK DRPRFIKLLQ QEDLEKMKIP EKFVQQHLTE TYTNNHQNAI  180
IVCPLGKFWR VELQREQPDV LLRDGWAPFL AAHDLSEGNI LLFRYEGNMV FTVEVFLQNG  240
CLKEYKTAAL YLTDGTEGPS NAPQQSAAKV HLSSGKGREE LRSVRGTFCS QIGLLEACAI  300
TLKISMKKKG SWRVAFKTAN TYGYINGPGW RKFCLENEVK EGDCLTFNAI ETTVWHVVIV  360
HC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047920.0AP004792.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0505A04.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642659.10.0PREDICTED: putative B3 domain-containing protein Os06g0632500 isoform X2
SwissprotQ67VL70.0Y6325_ORYSJ; Putative B3 domain-containing protein Os06g0632500
TrEMBLA0A0E0HTU00.0A0A0E0HTU0_ORYNI; Uncharacterized protein
STRINGORGLA06G0180700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.16e-13B3 family protein